Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASTKESDNASNSPSSPKTVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNASFRNGMAHPVNKELAHRQQFFFWKNYRNNRLKFILPKPPPEPVAAPAPLPPTAVPPQAAMPPVPATTIAMTSASPAPSSALSPMPYGLPPGSVLAKNDMRNSGIDRRKRKYERSLT |
Length | 211 |
Position | Middle |
Organism | Theobroma cacao (Cacao) (Cocoa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.544 |
Instability index | 64.33 |
Isoelectric point | 9.45 |
Molecular weight | 24128.42 |
Publications | PubMed=23731509 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP00542 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.85| 24| 27| 131| 157| 1 --------------------------------------------------------------------------- 134- 157 (47.69/24.27) PPEPVA..APAPLPPTAVPPQA.AMPP 159- 185 (35.16/10.26) PATTIAmtSASPAPSSALSPMPyGLPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.29| 20| 27| 31| 50| 2 --------------------------------------------------------------------------- 31- 50 (36.64/22.98) FLLELEFVQCLANPTYIHYL 61- 80 (36.65/22.99) FIGYLKYLQYWQRPEYIKFI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GIDRRK 2) YRNNRLKF | 198 121 | 203 128 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab