<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00539
| Description |
Uncharacterized protein isoform 2 (Fragment) |
| Sequence | MEENPLNATTPTSSNTKTTQELAAEGLKHLEETIEAAFQILSSMNDELCNPALWSTIPSSSNSTTASSTTTANTAAPNGPSSLSNGDSASDGGHHLEMGGIGGSGNGALDEARLRYKNSVASLRAVLAAIPNSQKELANKNE |
| Length | 142 |
| Position | Head |
| Organism | Theobroma cacao (Cacao) (Cocoa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.523 |
| Instability index | 36.62 |
| Isoelectric point | 4.75 |
| Molecular weight | 14615.71 |
| Publications | PubMed=23731509
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00539
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.31| 15| 44| 4| 18| 1
---------------------------------------------------------------------------
4- 18 (28.60/14.53) NP.LNATTPTSSNTKT
50- 65 (25.71/12.45) NPaLWSTIPSSSNSTT
---------------------------------------------------------------------------
|