<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00529
| Description |
Surfeit locus protein 5 subunit 22 of Mediator complex |
| Sequence | MNKGTGVGTGPTAAAAAAAAQKQKTMMQRVETDIGNIVENFTQLVNVARVNDPPVGNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRSVEFDQQAKKTDRMLARIGEEAAASLKELESHYYSSARRTAESA |
| Length | 148 |
| Position | Head |
| Organism | Theobroma cacao (Cacao) (Cocoa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.375 |
| Instability index | 33.13 |
| Isoelectric point | 6.13 |
| Molecular weight | 16037.93 |
| Publications | PubMed=23731509
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00529
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 13| 18| 29| 41| 1
---------------------------------------------------------------------------
29- 41 (23.29/16.88) RV.ETDIGNIVENF
49- 62 (20.36/14.08) RVnDPPVGNSQEAF
---------------------------------------------------------------------------
|