<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00513
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPFYRLYKDYLQNPKSAPEPPPPIEGTYVCFGGSYTTDDLLPSLEEQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQALEDIKRYVAGVSWKGSHVVMEPELVVVWLC |
Length | 173 |
Position | Middle |
Organism | Theobroma cacao (Cacao) (Cocoa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.371 |
Instability index | 68.77 |
Isoelectric point | 7.80 |
Molecular weight | 19978.86 |
Publications | PubMed=23731509
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP00513
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.43/11.47) P.PPPPFYRLY
27- 37 (19.23/ 7.79) PePPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.10| 25| 44| 74| 98| 2
---------------------------------------------------------------------------
74- 98 (39.19/28.31) LRSLN.RELQLHILELADVLVERPSQ
99- 117 (20.82/11.97) YARRV.EEISLIFKNLHHLL......
120- 142 (31.09/21.11) LRPHQaRATLIHILELQ...IQRRKQ
---------------------------------------------------------------------------
|