<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00502
Description |
Phytochrome and flowering time regulatory protein isoform 1 |
Sequence | MAERQLIVAVEGTAAMGPYWQTVVSDYLDKIIRCFSSSELTGQKTSTSNVELALVTFNTHGSYCACLVQRSGWTKDVDIFLQWLSAIPFSGGGFNDAAIAEGLSEALMMFPIAPNGNQTQQNVDGQRHCILVAASNPYPLPTPVYRPQIQNLEQTENIEAQTESRLSDAETVAKSFAQCSVSLSVICPKQLSKLKTIYSAGKRNPRAPDPPVDNVRNPPFLVLISENFMEGRAALSRPGVPSLASNQSPVKMDMASVTSGTGPPPTSVPSVNGSMMSRQPVSVGNVPTATIKVEPTTITSMGTGPAFPHIPAVPRAPSPAIPTMQTSSPSTTSQEVMNSGDNVQELKPSVSGMTQPLRPVPPAANVNILNNLSQARVMNSAALTGGTSIGLPSMGQTPVAMHMSNMISSGMASSVPPAQTVFSSGQSCMTSLTGSGALTGTVQVPPNSGLSSFASATSNVTANSNIGMSQPMGNVQSGVSMGQSVPGMSQGNHSGAQMVQSGVGMSQNMSGLGPSTVSSGTGTMFPIPGMSQQVQSGMQTLGVSNSSAASMPLSQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLAAHWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQHQQQQQLQQQQHQQMQPQLQQQQLPQLQQQQQQLPQLQQQQQPLPQLQQQQQQQQLPQLQQQQLPHLQQQQLPQLQQQQQHPQIQQQQQLPQIQQQQLSQLQQQQQLPQMQQQQQLPQMQQQPQLPQLQQQQLPQQQQMVGSGMGPAYVQGPGRSQLVSQGQVSSQAPPNMPGGGFMG |
Length | 871 |
Position | Unknown |
Organism | Theobroma cacao (Cacao) (Cocoa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.400 |
Instability index | 70.20 |
Isoelectric point | 8.78 |
Molecular weight | 93607.99 |
Publications | PubMed=23731509
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | DNA binding GO:0003677 IEA:EnsemblPlants
|
GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants
jasmonic acid mediated signaling pathway GO:0009867 IEA:EnsemblPlants
positive regulation of defense response GO:0031349 IEA:EnsemblPlants
positive regulation of flower development GO:0009911 IEA:EnsemblPlants
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
red, far-red light phototransduction GO:0009585 IEA:EnsemblPlants
response to far red light GO:0010218 IEA:EnsemblPlants
response to red light GO:0010114 IEA:EnsemblPlants
trichome branching GO:0010091 IEA:EnsemblPlants
trichome papilla formation GO:1905499 IEA:EnsemblPlants
|
Interaction
Repeat regions
Repeats |
>MDP00502
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.92| 15| 15| 776| 790| 1
---------------------------------------------------------------------------
768- 785 (31.33/ 6.32) LQQQQqhpQIQQQQQLPQ
786- 802 (30.58/ 6.01) IQQQQ.lsQLQQQQQLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 148.79| 19| 19| 710| 728| 2
---------------------------------------------------------------------------
700- 719 (38.21/10.35) LQQQQHQQMqPQLQQQQLPQ
720- 739 (38.95/10.70) LQQQQQQLPqLQQQQQPLPQ
752- 767 (30.77/ 6.82) LQQQQ....lPHLQQQQLPQ
803- 820 (40.86/11.61) MQQQQQ.LP.QMQQQPQLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 249.67| 40| 40| 467| 506| 3
---------------------------------------------------------------------------
385- 409 (35.36/10.04) G.GTS..............iGL....P...........S...............MGQ..TPVAMHMSN.....MISS
410- 446 (42.63/13.72) ..GMA...............SS..VPPA......QTVfSS.GQS..........CMT..SLTG..SGALTGTVQVPP
447- 501 (66.14/25.63) NSGLSsfasatsnvtansniGM..SQPM......GNV.QS.GVS..........MGQ..SVPGMSQGNHSGAQMVQS
502- 536 (47.41/16.15) GVGMS.........qnmsglG.....P.......STV.SS.GTG..........TMF..PIPGMSQQ.......VQS
537- 566 (29.21/ 6.92) G...................................M.QTlGVS..........NSSaaSMP.LSQQTSSALQSAQS
574- 627 (28.92/ 6.78) G.NLS...............GQrqGQPVfitrleGYR.SA.SASetlaahwpqtM.Q..IVRLISQDHMNNKQYV..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 220.07| 39| 39| 301| 339| 4
---------------------------------------------------------------------------
205- 225 (27.65/ 9.37) ..................PRAPDP....PVDNVR.NPPFL....VLIS
228- 259 (41.12/17.75) FMEGRA.....AL.....SR...PG..VPSLASNqSPVKMDM.ASVTS
260- 299 (32.27/12.25) .GTGPPPTSVPSVngsmmSRQPVSVgnVPTATIKvEPTTI.......T
301- 339 (70.58/36.07) MGTGPAFPHIPAV.....PRAPSPA..IPTMQTS.SPSTTSQ.EVMNS
341- 380 (48.46/22.31) DNVQELKPSVSGM...tqPLRPVP....PAANVN.ILNNLSQaRVMNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.75| 26| 772| 68| 94| 7
---------------------------------------------------------------------------
68- 94 (45.99/27.50) VQRSGWTKDVDIfLQWLSAIP..FSGGGF
842- 869 (44.75/22.16) VQGPGRSQLVSQ.GQVSSQAPpnMPGGGF
---------------------------------------------------------------------------
|