<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00494
| Description |
Uncharacterized protein |
| Sequence | MDKVVDSLNNAYQEFVSAAGDVLETTASCNGETTAAADAALENFKKKWETFRAACDQADEFVDSFKQSITSNTTFPVNEDMIDIFDNAVVDFD |
| Length | 93 |
| Position | Tail |
| Organism | Theobroma cacao (Cacao) (Cocoa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.295 |
| Instability index | 27.69 |
| Isoelectric point | 4.05 |
| Molecular weight | 10216.99 |
| Publications | PubMed=23731509
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.90| 15| 17| 23| 38| 1
---------------------------------------------------------------------------
23- 38 (20.30/15.31) LETTAScNGET.TAAAD
41- 56 (23.60/12.21) LENFKK.KWETfRAACD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.66| 11| 17| 59| 69| 2
---------------------------------------------------------------------------
59- 69 (18.21/ 8.70) DEFVDSFKQSI
79- 89 (18.45/ 8.88) EDMIDIFDNAV
---------------------------------------------------------------------------
|