<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00491
| Description |
Mediator of RNA polymerase II transcription subunit 19 isoform 2 (Fragment) |
| Sequence | GNLRTTRSANLHPPVSSCGFFSFLVVDEEELLVKFVIDSMDLESNRFGRGPKELGGAVDLIKKFKLWPHHEFFCKRPLPLSISETTYIRNVVGDTEIRKGKGMELDQLFPNASDSRGRNLSIGPFDLDLLGEAFQMRESACVDLPLAEKGIPTMVSKSKAESKDKKRKHRKQKDKEKEKDKNSKEHKHHHKDMTSDRNKNKIRHHDSGPEDLKKPQDKKRRYAVNDDFLDVHRHQNGQNPRRIERGKLKVAG |
| Length | 252 |
| Position | Head |
| Organism | Theobroma cacao (Cacao) (Cocoa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.022 |
| Instability index | 40.96 |
| Isoelectric point | 9.59 |
| Molecular weight | 28955.64 |
| Publications | PubMed=23731509
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00491
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 61.79| 12| 51| 163| 174| 1
---------------------------------------------------------------------------
163- 174 (21.09/12.26) KDKKRKHRKQKD
179- 190 (21.27/12.43) KDKNSKEHKHHH
216- 227 (19.43/10.71) QDKKRRYAVNDD
---------------------------------------------------------------------------
|