Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MATEQLADILLTIDPKLVDEHVDAFLLDEDKLTLPQLLPRIIHERGQFTNITESSLEQELRGDSSLPDEDTNMEETDLNSESYPNTSTQTSTTTNEEFYKKKNEVLKHISIALNESSLALDFVSLLISCVRPAAGTISMSSHLKKFVPPGSLNADKVSVQITPEQREDMYKEQKNVGQGWKLSSLESSSTNLRSASARLCEEVQRERVFWDTIKKNFNEKEILYKTRDKTSGKRLFAVKYGYEDSGSTYRITGNAMLKPLQDDRIEFVPLSSRGGGVKRIVRVRILRKEENDDDYSIVGESRTDGGFANDDSIKTRIEKARFFIFEEELFSQLIDEATGLIAYNVKAESESKISIGLQDETIEIEHVEYEEDNVDNGDRAPKPEDDRAEMCVTFLRLMLTVKHKKNLESKKQLTVIKASSSSRNLMKPYSLILRPLVGHFIHEHMIQLLYSMVKNLLHNLDGAQFKLRRYINLNKEELKKDPMKRISEPAVSKFTLKVPQKLKIVLELNSFDLVNFRVNTTTFVSGKKVLESTFEDIRQIEECLEWLIADYSG |
Length | 553 |
Position | Head |
Organism | Cyberlindnera fabianii (Yeast) (Hansenula fabianii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Cyberlindnera. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.519 |
Instability index | 45.79 |
Isoelectric point | 5.45 |
Molecular weight | 63229.03 |
Publications | PubMed=25103752 PubMed=28385833 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00476 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 108.05| 34| 70| 87| 120| 1 --------------------------------------------------------------------------- 87- 120 (54.17/34.48) STQTSTTTNEEFYKKKNEVLKHISIA.LNESSLAL 158- 192 (53.88/34.27) SVQITPEQREDMYKEQKNVGQGWKLSsLESSSTNL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 116.18| 30| 295| 53| 84| 3 --------------------------------------------------------------------------- 54- 84 (46.02/32.87) SSLEQELRgDSSLPDEDTNMEETDL.NSESYP 325- 349 (28.16/13.52) ..FEEELF..SQLIDEATGLIAYNV.KAES.. 351- 381 (42.00/20.71) SKISIGLQ.DETIEIEHVEYEEDNVdNGDRAP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.39| 16| 27| 261| 276| 5 --------------------------------------------------------------------------- 261- 276 (29.24/17.78) QDDRIEFVPLSSRGGG 291- 306 (29.15/17.71) NDDDYSIVGESRTDGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KRLFAVKYGY 2) VKRIVRVRILRK | 233 277 | 242 288 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab