| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAQVNNQAVEQEIEKTKQIISDLVESFIELGIIVHDFQGTESSRDALSLRLNHTIDELQKLQSPATNSLDNVPVPLDVLQYVEDGRNPDVYTREFVETTRKANQHLRGKMMAMRDLRDVLGKKIASEFPELGDVVQDIIKRTDG |
| Length | 144 |
| Position | Middle |
| Organism | Cyberlindnera fabianii (Yeast) (Hansenula fabianii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Cyberlindnera. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.483 |
| Instability index | 52.24 |
| Isoelectric point | 4.85 |
| Molecular weight | 16318.24 |
| Publications | PubMed=25103752 PubMed=28385833 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP00472 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LSLRLNHTIDELQKLQ 2) NVPVPLDVLQYV 3) YTREFV | 47 71 91 | 62 82 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab