<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00470
| Description |
Uncharacterized protein |
| Sequence | MSHFCLLMFPPPLLFSPIPNFPSPSLYSTLLPPSRFWLGEQRCRQSVKHLPTICTDILHLSNSASHPASSLSKHRLFIRLTRLPQYYIVVEMLDMPGCPTELHYKYSFLSVSQLEGEEGPPCAQLLQQFKPNLEQLVLDNSAGQGARPGAKRKVGMDCRIGGNDLRYS |
| Length | 168 |
| Position | Tail |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.197 |
| Instability index | 57.46 |
| Isoelectric point | 8.80 |
| Molecular weight | 18912.77 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00470
No repeats found
No repeats found
|