<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00467
Description |
Uncharacterized protein |
Sequence | MDLPIKPGANQVADVVFVIEGTANLGPYFESLRKHYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAVESVSYTGCTADNLVKIIRDRGIHFSVVSPRKLPALRALFDRASPVGGQVDPHPDYSQDPFHMILVRGISLPVSSGGGSGPLKPILPPQPLPVSQPPLGPASQAPPPISTAHPYQPPPSLNAAQAAAQMAVEAANNQKSRCEYQ |
Length | 296 |
Position | Unknown |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.063 |
Instability index | 49.73 |
Isoelectric point | 5.30 |
Molecular weight | 31602.61 |
Publications | PubMed=24755649
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00467
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.69| 17| 18| 233| 249| 1
---------------------------------------------------------------------------
197- 212 (31.29/12.41) PVGGQVDP..HP.DYSQDP
233- 249 (33.69/13.89) PLKPILPP..QPLPVSQPP
252- 270 (29.71/11.43) PASQAPPPisTAHPYQPPP
---------------------------------------------------------------------------
|