<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00460
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAVTDKSTKERLLSVLDDLEVLSRELIEMLALSRSQKLPQGGEDTQILELLVQRDREFQELMRVAQEQGKVHQEMQVLEKEVEKRDCDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMSNLPTNGVNGHLPGDALAAGRLPDVLTPQYPWQSSDVSVGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
Length | 252 |
Position | Middle |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.654 |
Instability index | 50.05 |
Isoelectric point | 5.03 |
Molecular weight | 28015.17 |
Publications | PubMed=24755649
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00460
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.93| 18| 32| 24| 55| 1
---------------------------------------------------------------------------
19- 36 (27.89/ 7.53) LEVL...SRELIEMLALSRSQ
48- 68 (25.03/32.13) LELLvqrDREFQELMRVAQEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.43| 14| 32| 140| 153| 2
---------------------------------------------------------------------------
140- 153 (28.63/16.60) SNAVCAPLN.WVPGD
173- 187 (22.80/12.12) SNLPTNGVNgHLPGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.81| 30| 33| 71| 102| 3
---------------------------------------------------------------------------
71- 102 (42.50/40.45) VHQEMQVLeKEVEK.RDCDIQQlQKQLKEAEHI
107- 137 (44.31/31.68) VYQAKEKL.KSIDKaRKGSISS.EEIIKYAHRI
---------------------------------------------------------------------------
|