<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00459
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MGEPQQVSALPPPPMQYIKEYTDENIRKGLIPKPPPPIRDTYMMFGNQFQCDDLIIRPLESQGIERLHPMQFHHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLASLPHDLPQIEGLSGAGDTEPMDVEEAGTSCMAVGPQQDKSMGGAAKKDRVLDKDAAMCSIIDEIA |
| Length | 234 |
| Position | Middle |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.483 |
| Instability index | 46.00 |
| Isoelectric point | 5.87 |
| Molecular weight | 26768.83 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00459
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 16| 26| 75| 92| 2
---------------------------------------------------------------------------
75- 92 (21.28/24.60) KRELKKLNMSILvnFLDL
104- 119 (26.80/21.69) KREEKLEDLKLL..FVHM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.68| 22| 27| 177| 198| 3
---------------------------------------------------------------------------
177- 198 (37.18/24.56) QIEGLSGAGDTEP.MDVEEAGTS
206- 228 (33.51/21.52) QDKSMGGAAKKDRvLDKDAAMCS
---------------------------------------------------------------------------
|