<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00455
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSNLYGQNEAQGPPGSSSLGFGPGKPPPPLPPNQVTMAAQMPPQHGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIEKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKNKHKHHRPQDPIPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR |
| Length | 244 |
| Position | Head |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.156 |
| Instability index | 51.65 |
| Isoelectric point | 9.74 |
| Molecular weight | 27020.52 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00455
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.46| 23| 26| 14| 36| 1
---------------------------------------------------------------------------
14- 36 (47.01/20.21) AQGPPGSSSLGFGPGKPPPPLPP
43- 65 (45.45/19.29) AQMPPQHGDEGPALRKPGAMNEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.99| 20| 20| 187| 206| 2
---------------------------------------------------------------------------
159- 184 (23.40/ 7.33) .PLPEqyrlmhiQPPKKKSKNKHKHHR
187- 206 (36.41/14.96) DPIPQ.......ETPSDSDPKKKKKKR
209- 225 (29.18/10.71) DPDRK.......KKKKD...KKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.58| 18| 21| 109| 128| 3
---------------------------------------------------------------------------
109- 128 (30.71/21.73) FL..PELPGMIDCPGTqdGSSL
131- 150 (27.86/13.76) LIekPPVCGNSFSPLT..GASL
---------------------------------------------------------------------------
|