<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00453
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MEGWLAVTVSGLVTVSLLKPNGQLGLRGRVALADIAFTGGGNIVVAATDGSSSSPVQFYKVCVSVVNEKCRIDTELLPSLFMRCTTDPVRRDKYPAVTHLKFLTRENSEQVRGTHCEHTVFPSVLYWELFPAFSLTITT |
Length | 139 |
Position | Tail |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.166 |
Instability index | 36.41 |
Isoelectric point | 7.70 |
Molecular weight | 15234.40 |
Publications | PubMed=24755649
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00453
No repeats found
|