<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00451
| Description |
Uncharacterized protein |
| Sequence | MTKTILLWYKSYIHSDGLRSFDVKSNKCFLKTRFSYAFPKEFPYRMNHVLECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRVVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYDQWKNFDDRKEMAAVLNKMPKPKPPPNRVRERRRSAAEDTDPAAGTGQPPGEMAPIPFFLASRIATTPLHA |
| Length | 223 |
| Position | Kinase |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.194 |
| Instability index | 54.15 |
| Isoelectric point | 8.41 |
| Molecular weight | 26114.35 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00451
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.53| 10| 27| 65| 74| 2
---------------------------------------------------------------------------
65- 74 (19.90/10.30) IVYHPYRPLL
93- 102 (17.63/ 8.50) VVNDTYRTDL
---------------------------------------------------------------------------
|