<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00441
Description |
Uncharacterized protein |
Sequence | MKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTIAVVLKSKMLFFLQLTQRLPLPQEPVNIIVPIVYDMATGLTQQADIPRQHSSSGAAALMVSNILKRFSELHPARQGECTIFASVHELMANLNLTPGGRQ |
Length | 134 |
Position | Tail |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.127 |
Instability index | 57.96 |
Isoelectric point | 8.74 |
Molecular weight | 14712.13 |
Publications | PubMed=24755649
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00441
No repeats found
No repeats found
|