Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVSVLPITGGTINMMEYLLQGSVLDQALESLLHRLRGLCDNMEPETFADHELVYLLKGQQGNPFLLRARRSLSHPTVPWHLRYLGQPEVGDKSRHALVRNCVDVATSHSLPDFLNEMGFRMDHEFVAKGHIFRRGVLKVVVSKLSRILVPGNTENTEPLSLSYLVELSVLAPAGQDTMSEDMRSFAEQLKPLVHLEKIDPKRHM |
Length | 208 |
Position | Head |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Oncorhynchus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.185 |
Instability index | 46.98 |
Isoelectric point | 6.36 |
Molecular weight | 23425.84 |
Publications | PubMed=24755649 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00440 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 154.40| 38| 144| 11| 48| 1 --------------------------------------------------------------------------- 11- 48 (65.57/32.85) ITGGTINM....MEYLLQGSVLDQA.LESLLHRLRGLCDNMEP 56- 82 (37.58/16.60) ............LVYLLKG...QQG.NPFLLRARRSLSHPTVP 153- 195 (51.25/24.54) VPGNTENTeplsLSYLVELSVLAPAgQDTMSEDMRSFAEQLKP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HLRYL 2) LVHLEKIDPKRHM | 84 196 | 88 208 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab