Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAEKFDNLEEHLEKFVENIRQMGIIVSDFQPSSQTGLNQKLNYMITGLQDIEKCRQQLHEINVPLEAFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISELGKVFPEEMTKYKAIHGDDPPS |
Length | 134 |
Position | Middle |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Oncorhynchus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.640 |
Instability index | 46.66 |
Isoelectric point | 5.25 |
Molecular weight | 15505.56 |
Publications | PubMed=24755649 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | atrioventricular canal development GO:0036302 IEA:Ensembl cardiac jelly development GO:1905072 IEA:Ensembl regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00437 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LYTKECLERALAK 2) TKYKAIHG | 79 122 | 91 129 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab