<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00431
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MAPVQIGSDGQLVPIGGPTSATQPPSSGPQATQGVRLSLLIEFLLQRTYHEITLLGELLPRKTDMERKIEIVQFSSRTRQLFVRLLALVKWASNAGKVEKCAMISSFLDQQAFLFVDTADRLASLARDALVHARLPSFAIPFAIDVLTTGSYPRLPTCIRDKIIPPDPITKVEKQTTLNQLNQILRHRLVTTDLPPQLANLTVVNGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDCRALVHSMQVNFIHELVQSRLFADEKPLQDMYSCLHSFCLSLQLEVLHSQTLMLYRERWGDLVQVEHYMPAKCLTLAVWNQQVLGRKTGTASVHKVTIKIDESDGSKPLQISHDPPLPACDSRLMERAMKIDHLSVEKLLIDSVHARSHQKLQELKAILKSSNPSDSSFIETALPTLVIPILEPCGRSECLHIFVDLHSGMFHPMLYGIDQSMLDDIEKTINDDMKRIISWLQQLK |
| Length | 483 |
| Position | Tail |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.080 |
| Instability index | 44.19 |
| Isoelectric point | 6.36 |
| Molecular weight | 54419.64 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 213.83| 60| 71| 97| 156| 1
---------------------------------------------------------------------------
97- 156 (102.77/68.24) KVEKC.AMISS....FLDQ..QAFLFVDTADRLASLARDALVHARLPS.............FAI..PFAIDVLTTGSYPRLP
171- 230 (60.32/36.99) KVEKQ.T.....................TLNQLNQILRHRLVTTDLPPqlanltvvngrvkFRVegEFEATLTVMGDDPDIP
245- 294 (50.74/29.93) TGD.CrALVHSmqvnFIHElvQSRLFADEKP.LQDM......YSCLHS.............FCL..SLQLEVL.........
---------------------------------------------------------------------------
|