<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00422
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAGVMESEEQARNRFQSELEFIQCLANPNYLNFLAQRGYLREKPFVNYLKYLLYWKEPEYAKFLNKEARSLTVGPERHPQVSFFARHWITSLVFGTLQIIVWGTEKRYPHCLHMLELLQYEHFRKELVNAQCAKFIDEQQLLHWQHYSRKRTRLQQALAEQQQQQQLPHGNATAK |
| Length | 175 |
| Position | Middle |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.631 |
| Instability index | 50.66 |
| Isoelectric point | 9.13 |
| Molecular weight | 21011.81 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.06| 20| 21| 120| 140| 1
---------------------------------------------------------------------------
120- 140 (30.75/27.12) YEHFRKELVNAQCAkFIDEQQ
144- 163 (35.30/25.78) WQHYSRKRTRLQQA.LAEQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.97| 20| 28| 15| 34| 2
---------------------------------------------------------------------------
15- 34 (36.50/24.53) FQSELEFIQCLANPNYLNFL
45- 64 (37.47/25.37) FVNYLKYLLYWKEPEYAKFL
---------------------------------------------------------------------------
|