<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00421
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAVADKSTKERLLLVLDDLEVLSRELIEMLALSRSQKLPQGGEDTQILELLVQRDKEFQELMRVAHEQGKVHQEMQVLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKAKKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGLLGHMSNLPTNGVNGHLPGDALAAGRLPDVLTPQYPWQSSDVSVGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
Length | 252 |
Position | Middle |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.625 |
Instability index | 48.91 |
Isoelectric point | 5.09 |
Molecular weight | 27930.10 |
Publications | PubMed=24755649
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00421
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.67| 18| 28| 44| 61| 1
---------------------------------------------------------------------------
44- 61 (30.30/17.55) DTQILELLV.QRDKEFQEL
74- 92 (24.37/13.07) EMQVLEKEVeKRDSDIQQL
---------------------------------------------------------------------------
|