<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00409
| Description |
Uncharacterized protein |
| Sequence | MMAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAKNVNFNPSKISSNFSSIIAEKLRYNTFPDTGKRKPQVNQKDNFWLVTARSQSSINNWFTDLAGTKPLTQLAKKVPIFSKKEEVFGYLAKYTVPVMRSAWMIKMTCAYHAAITETKVKKRHVIDPCIEWTQIITKYLWEQLQKVAEFYRQSPSQGCGSPLPANPAEVDTAMKQWEYNEKLAMFMFQVGWSFGLSVVFCCLFACLSQVPRLSPPGTYVPAISDAFEKQNKFASVGRA |
| Length | 295 |
| Position | Kinase |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.392 |
| Instability index | 46.22 |
| Isoelectric point | 9.37 |
| Molecular weight | 33377.04 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00409
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.41| 20| 247| 18| 37| 2
---------------------------------------------------------------------------
18- 37 (39.96/21.12) PRLGPPDVY.P..QDPKQKEDEL
267- 289 (30.45/14.69) PRLSPPGTYvPaiSDAFEKQNKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.84| 21| 37| 139| 159| 3
---------------------------------------------------------------------------
139- 159 (36.94/23.21) KKEEVFGYLAKYTVPVMRSAW
177- 197 (39.89/25.55) KKRHVIDPCIEWTQIITKYLW
---------------------------------------------------------------------------
|