<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00403
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MLNNILMLLTVVLCVLSPLLSVCQVPLAEGKSVQQTIDILHKKLEQLSAVKQGNFTVDCETYHATGNASGQPTKLLYVMHNSETPLSCLALFEGGPCLTADGNFDVLMIKLKSHFQNAKGHKVESRGSRYRYCDFLIKVGAVTMSSSARGISVEVEYCPCVVPGDCWNLMKEFMQSFLGPSIPELPSVFATKPEGLYVPADCVDTMTQYLELFSKVRKQQVLPGTTR |
Length | 227 |
Position | Head |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.090 |
Instability index | 33.13 |
Isoelectric point | 6.93 |
Molecular weight | 24985.90 |
Publications | PubMed=24755649
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00403
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.87| 16| 35| 162| 177| 1
---------------------------------------------------------------------------
162- 177 (33.51/23.17) VPGDCWNLMKEFMQSF
198- 213 (30.36/20.40) VPADCVDTMTQYLELF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.53| 26| 37| 23| 48| 2
---------------------------------------------------------------------------
23- 48 (44.12/35.31) CQVPLAEGK...SVQQT..IDILHKKLEQLS
59- 87 (36.63/28.06) CETYHATGN..aSGQPTklLYVMHNSETPLS
88- 112 (24.78/16.58) C.LALFEGGpclTADGN..FDVLMIKLK...
---------------------------------------------------------------------------
|