<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00395
Description |
Uncharacterized protein |
Sequence | MTTPPIVAFAGQQAQAARDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPSTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENCTGLDPVPPEQLIPYVEDDSSKHDERLASQARPATEERREILEVNKKLKQKNQQLKQIMDQLRNLIWEINSMLAVRS |
Length | 171 |
Position | Head |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.550 |
Instability index | 53.24 |
Isoelectric point | 8.48 |
Molecular weight | 19744.52 |
Publications | PubMed=24755649
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.39| 17| 52| 51| 67| 1
---------------------------------------------------------------------------
51- 67 (32.82/26.41) QLPNGVTYHPSTHQDRL
105- 121 (30.56/24.14) QLIPYVEDDSSKHDERL
---------------------------------------------------------------------------
|