<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00393
| Description |
Uncharacterized protein |
| Sequence | MATPLPQKGPGLAGMLSQQQQSHLPPGLGPGQPPMLPQGALREISPVFLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSQAVYQDRFGKLQEHLRQLALLFRKLRLLYERCVEMTSDLQEEPSELVPYVREEMAPVRVEPCSPAVSQERREVLEKMRQKNQEMKILMDQMRNLLWDVNAMLTLRK |
| Length | 189 |
| Position | Head |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.431 |
| Instability index | 65.10 |
| Isoelectric point | 8.50 |
| Molecular weight | 21661.06 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.88| 13| 17| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (25.99/10.35) PQKGPGLAGMLSQ
26- 38 (28.88/12.07) PGLGPGQPPMLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.06| 15| 17| 47| 63| 2
---------------------------------------------------------------------------
47- 63 (20.51/23.43) VFlcRIGQET.VQDIVTR
67- 82 (21.55/14.96) IF..QITRATqLPNGVTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.17| 10| 15| 125| 136| 3
---------------------------------------------------------------------------
125- 136 (14.46/13.56) EPSElvPYVREE
143- 152 (19.72/11.33) EPCS..PAVSQE
---------------------------------------------------------------------------
|