<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00389
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLYGQNDAQGPPRSSSLGFGPGNPPPPLPPNQVPMAAQMPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDWPGTQDGSSLRSLIEKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHNRPQDPIPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSLR |
| Length | 242 |
| Position | Head |
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Oncorhynchus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.140 |
| Instability index | 55.14 |
| Isoelectric point | 9.80 |
| Molecular weight | 26932.48 |
| Publications | PubMed=24755649
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00389
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.90| 15| 17| 198| 212| 1
---------------------------------------------------------------------------
172- 190 (18.95/ 6.85) .PKKKskhkhKHNRPQDPIP
198- 212 (30.19/15.03) DPKKK.....KKKRDDDPDR
218- 230 (26.76/12.53) D.KKK.....KKNR.HSPDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.83| 16| 21| 28| 46| 2
---------------------------------------------------------------------------
28- 46 (28.57/18.05) GNPPPPLppnQVPMAAQMP
50- 65 (30.25/11.42) GDEGPAL...RKPGAMNEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.58| 16| 21| 111| 128| 3
---------------------------------------------------------------------------
111- 128 (28.10/20.52) PELPGMIDWPGTqdGSSL
135- 150 (31.47/16.63) PPVCGNSFSPLT..GASL
---------------------------------------------------------------------------
|