Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSTLYGQNDAQGPPRSSSLGFGPGNPPPPLPPNQVPMAAQMPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDWPGTQDGSSLRSLIEKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHNRPQDPIPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSLR |
Length | 242 |
Position | Head |
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Oncorhynchus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.140 |
Instability index | 55.14 |
Isoelectric point | 9.80 |
Molecular weight | 26932.48 |
Publications | PubMed=24755649 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00389 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 75.90| 15| 17| 198| 212| 1 --------------------------------------------------------------------------- 172- 190 (18.95/ 6.85) .PKKKskhkhKHNRPQDPIP 198- 212 (30.19/15.03) DPKKK.....KKKRDDDPDR 218- 230 (26.76/12.53) D.KKK.....KKNR.HSPDH --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.83| 16| 21| 28| 46| 2 --------------------------------------------------------------------------- 28- 46 (28.57/18.05) GNPPPPLppnQVPMAAQMP 50- 65 (30.25/11.42) GDEGPAL...RKPGAMNEP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.58| 16| 21| 111| 128| 3 --------------------------------------------------------------------------- 111- 128 (28.10/20.52) PELPGMIDWPGTqdGSSL 135- 150 (31.47/16.63) PPVCGNSFSPLT..GASL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDH 2) YRLMHIQ | 198 164 | 230 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab