<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00372
Description |
Uncharacterized protein |
Sequence | MLTVEGHVYSIGTDWLVRAGNVLLAGGAVKGMFLEAEYLPLPTMPTRANERGETDLQFLLSNLLLSVLPNVADARIVAVTIGDAQWEEILWEEPEEDEHKDKTAMDNDDDDIYAKEGDLPSVKKGDWIGVERDRRSAFLIIGALKQEGLL |
Length | 150 |
Position | Head |
Organism | Pycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.189 |
Instability index | 40.57 |
Isoelectric point | 4.36 |
Molecular weight | 16636.64 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00372
No repeats found
No repeats found
|