<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00369
Description |
Uncharacterized protein |
Sequence | MHAREVVFEPLDAQLQRDSGTEPVLLRARKELLEPEAKWLLYSYLKPESVRVHPEATVRAADDMDADDRRRSQIYKRGYVFRRGNLVIQMFQQEHADPKTGKPIPAHPDTLWEVEVKTAAPVRNTQETPLSQSLDAVLEVQLLMKGLLDLRRQDV |
Length | 155 |
Position | Head |
Organism | Pycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.603 |
Instability index | 56.08 |
Isoelectric point | 6.10 |
Molecular weight | 17880.21 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00369
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.07| 21| 22| 2| 23| 1
---------------------------------------------------------------------------
2- 23 (32.86/21.50) HAREVVFEPlDAQLQRDSGTEP
27- 47 (37.21/20.41) RARKELLEP.EAKWLLYSYLKP
---------------------------------------------------------------------------
|