| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSQTTNQVALSQSAFGGPSQSYTTQQPSHALPAGSDVNPPSSAPMTEILLEPLSRLQSLSHTLFLSLGPPQNRPPPPPSVSELLAVDAQLAAAVRLAQTHQVKQRRIERLKEEVLELDRRWRDVVGTLDEGRRELDAIIREGEERIKAIEEAKAAAIPYPELLAYAQSLSAFTSAPPNMPDLAPGQPPPPLFFPPFPNEEKMRRGHMNDEAPLGILGETHSVGKPPTISPQVELPTRMAANPYRLDHRPPPQQQQFFDLDLDLNPDL |
| Length | 267 |
| Position | Middle |
| Organism | Pycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Polyporaceae> Trametes. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.528 |
| Instability index | 73.66 |
| Isoelectric point | 5.20 |
| Molecular weight | 29389.91 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP00368
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 128.03| 30| 111| 44| 78| 1
---------------------------------------------------------------------------
25- 43 (27.64/ 6.53) .............QQPSHA..LPAGSDVN.P......PSSA
44- 78 (50.78/27.41) PMTEILleplSRLQSLSHTlFLSLGPPQNRP......PPPP
158- 190 (49.62/17.83) PYPELL....AYAQSLSA..FTSAPP..NMPdlapgqPPPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FFDLDLDLN 2) PYRLDHR | 256 242 | 264 248 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab