Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MTTSLKNSDDPSTSPSSPKNVLKEDDGGRRRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYLKFIMYPHCLFFLELLQNANFRNAMAHPSNKELAHRQQFFFWKNYRNNRLKHIMPRPLPEPPAVTPTPAPPQGPTPPMSATIAATAPPPPALSPMQYGVLPGSSLAKNDMRNAAVDRRKRKKEA |
Length | 201 |
Position | Middle |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.665 |
Instability index | 62.25 |
Isoelectric point | 9.61 |
Molecular weight | 23151.32 |
Publications | PubMed=24919147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP00362 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.68| 20| 27| 32| 51| 2 --------------------------------------------------------------------------- 32- 51 (36.42/21.46) FLLELEFVQCLANPTYIHYL 62- 81 (36.27/21.35) FIGYLKYLQYWQRPEYLKFI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.40| 10| 15| 146| 155| 3 --------------------------------------------------------------------------- 146- 155 (22.80/ 7.02) APPQGPTPPM 163- 172 (21.60/ 6.38) APPPPALSPM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AVDRRK 2) YGVLP | 191 174 | 196 178 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab