<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00362
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MTTSLKNSDDPSTSPSSPKNVLKEDDGGRRRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYLKFIMYPHCLFFLELLQNANFRNAMAHPSNKELAHRQQFFFWKNYRNNRLKHIMPRPLPEPPAVTPTPAPPQGPTPPMSATIAATAPPPPALSPMQYGVLPGSSLAKNDMRNAAVDRRKRKKEA |
| Length | 201 |
| Position | Middle |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.665 |
| Instability index | 62.25 |
| Isoelectric point | 9.61 |
| Molecular weight | 23151.32 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00362
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.68| 20| 27| 32| 51| 2
---------------------------------------------------------------------------
32- 51 (36.42/21.46) FLLELEFVQCLANPTYIHYL
62- 81 (36.27/21.35) FIGYLKYLQYWQRPEYLKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.40| 10| 15| 146| 155| 3
---------------------------------------------------------------------------
146- 155 (22.80/ 7.02) APPQGPTPPM
163- 172 (21.60/ 6.38) APPPPALSPM
---------------------------------------------------------------------------
|