<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00357
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYKDYAQDPQSAPEPPAPVEGTYTCFGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHLLELADVLVERPSQYARRVEEISLIFKNLHHLLNSLRPHQARATLIHILELQIQQRKQAVEDIKRRREEVQRLLKESLGTLDGH |
| Length | 168 |
| Position | Middle |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.674 |
| Instability index | 74.65 |
| Isoelectric point | 6.60 |
| Molecular weight | 19435.89 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.51| 29| 45| 74| 112| 1
---------------------------------------------------------------------------
72- 106 (42.33/43.18) KELRSLNRELQ........LHLLELadvlveRPSQYARRVEEI
111- 147 (42.18/21.37) KNLHHLLNSLRphqaratlIHILEL......QIQQRKQAVEDI
---------------------------------------------------------------------------
|