<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00356

Description Uncharacterized protein
SequenceMAMKSDSLDYWRHYFRTANCDIFDIIDRAIIVAASDCPKEFRLRRDRIAERLFTCRLTRCLGCDRVELAVPSGDEDDELKGGIAGEGCDFEAGGSKESKVNSSRDDHGELFMNQESNYSYGEAEALTDEMEEESQIHEEVLRIKEILLNSDEESESALYESLRRLQLMALTMGILKATGIGKAVNPLRKHKSKPIRRLSQTLIMAWKTMVEEWMQGAPPAGSTPDSVNPSSDDEEEEEGEEEGEEEEGLPSPPLDEGAFLPPHTSTMELSRFFDGMDDDGNPRTGGESAKNREYGRKPSQEKQNVSEQRRERKPDGVKDSLKDNSSQHLKKREDIVKPNRPSNTNAGQGRHTNLTTEQKVNKESKLQLRKLERTSAQRRMVRNQKDDAKYSIEVAVQMKLEATKRKLQESYQQVENAKKQRTIQVMDLHDLPKQSHGHRNLHMRPGNQNRHWANGRR
Length457
PositionUnknown
OrganismEucalyptus grandis (Flooded gum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
Aromaticity0.05
Grand average of hydropathy-1.079
Instability index55.71
Isoelectric point5.72
Molecular weight52139.50
Publications
PubMed=24919147

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00356
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.63|      19|      22|     287|     308|       1
---------------------------------------------------------------------------
  290-  308 (32.79/25.87)	KNRE.YGRKPSQEKQNVSEQ
  310-  328 (24.88/ 9.78)	RERKpDGVKDSL.KDNSSQH
  330-  348 (30.96/15.26)	KKRE.DIVKPNRPSNTNAGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.80|      21|      22|     122|     143|       2
---------------------------------------------------------------------------
  122-  143 (29.41/18.40)	EAEALTDEmEEESQIHEEVLRI
  145-  165 (33.40/16.62)	EILLNSDE.ESESALYESLRRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.15|      26|      27|     363|     389|       3
---------------------------------------------------------------------------
  363-  389 (37.56/29.79)	ESKLQLrKLERTSAQRRMVRNQKDDAK
  393-  418 (41.59/27.90)	EVAVQM.KLEATKRKLQESYQQVENAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     102.17|      17|      29|     242|     258|       4
---------------------------------------------------------------------------
   94-  109 (21.67/ 8.80)	.GSKESKVNSSRDDHGE
  220-  236 (27.09/12.75)	AGSTPDSVNPSSDDEEE
  242-  258 (28.08/13.47)	EGEEEEGLPSPPLDEGA
  274-  289 (25.33/11.46)	DGMDDDGNPRTG.GESA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00356 with Med26 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MVEEWMQGAPPAGSTPDSVNPSSDDEEEEEGEEEGEEEEGLPSPPLDEGAFLPPHTSTMELSRFFDGMDDDGNPRTGGESAKNREYGRKPSQEKQNVSEQRRERKPDGVKDSLKDNSSQHLKKREDIVKPNRPSNTNAGQGRHTNLTTEQKVNKESKLQLRKLERTSAQRRMVRNQKDDAKYSIEVAVQMKLEATKRKLQESYQQVENAKKQRTIQVMDLHDLPKQSHGHRNLHMRPGNQNRHWANGRR
209
457










Molecular Recognition Features






MoRF SequenceStartStop




1) KPIRRL
193
198