<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00352
| Description |
Uncharacterized protein |
| Sequence | MPAFGRYKCLRGQGSGTRHASWLLDLLGKGIESALVYPSALVAEPWQLSSEMFSGIDPEARAAELALIPSIQVPSPSF |
| Length | 78 |
| Position | Tail |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.108 |
| Instability index | 54.09 |
| Isoelectric point | 5.64 |
| Molecular weight | 8374.54 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00352
No repeats found
No repeats found
|