<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00346
| Description |
Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
| Sequence | MAGAELGQQTVEFSALVGRAAEESFSSLKELVEKSKSGDQSDTEKKISLLKYLVKTQQRMLRLNVLAKWCKQVPLIQYCQQLSSTLSSHDTCFTQAADSLFFMHEGLQQARAPAYDVPSAIQVLLTGNYQRLPKCIEDVGAQGVLTEEEQKPVLKKLDTLVRTKLLELSIPKEISEVKVSDGTVLLSVDGEFKVLVTLGYRGHLSMWRILHLELLVGEKSGPIKLEESRKHVLGDDLERRMSVAENPFLTLYSVLHELCIALVMDTVIRQVQLLRQGRWKDAIRFELISDGGPSHTGPSSSQINQDGEVDSASLRTPGLKIMYWLDFSKGSGTSDSCPYVKIEPGPDLQIKCLHSTFVIDPLTGKEAEFSLDQSCINVEKLLLRAICCNRYTRLLEIQKELAKNSQICRVAGDVTLLSHTDELDVDFKKKYTEYEGHEVLHVRAYGSAFFTLGINIRNGRFLLRSTQNILSPSALSECEEALNQGSINSAEGFMSLRSKSILHLFASISRFLGLEVYENNFAAVKIPKSIANDSAMLLLGFPDCGSSYFLLMQLDNDFKPLLKLIETQPDMSGKINSLVTRIVQPV |
| Length | 586 |
| Position | Tail |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.111 |
| Instability index | 36.08 |
| Isoelectric point | 6.02 |
| Molecular weight | 65330.51 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00346
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 537.92| 181| 222| 163| 361| 1
---------------------------------------------------------------------------
163- 361 (269.09/207.85) TKLLElsIPKEI...SEV.KVSDGTVLLSVDGEFKVLVTLGYRGHLSMwRILHLElLVGekSGPIKLEESRKHvlGDDLERRMSVAENPfltlySVLHElCIALVMDTVIRQVQLLRQGRWKDAIR.FELISD..GGPSHTGP.SSSQINQDGEVDSASLRT..PGLKIMYWLDFSKgsgTSDSCPYVK.IEPGPDLQIKcLHS..TFVIDP
392- 585 (268.83/159.24) TRLLE..IQKELaknSQIcRVAGDVTLLSHTDELDVDFKKKYTEYEGH.EVLHVR.AYG..SAFFTLGINIRN..GRFLLRSTQNILSP.....SALSE.CEEALNQGSINSAEGFMSLRSKSILHlFASISRflGLEVYENNfAAVKIPKSIANDSAMLLLgfPDCGSSYFLLMQL...DNDFKPLLKlIETQPDMSGK.INSlvTRIVQP
---------------------------------------------------------------------------
|