Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MASMGVSGGNGVINPQNDVTSASQDDPKQDLNQVINSIQKTLGLLHQLYLNVSSFNTGLQLPLLQRINSLVLELDNMVKLSEKCHIQVPVEVLNLIDDGKNPDGFTKDIINGCIAKNQITKGKTDSFKGLRKHLLEELDQAFPDEADSFREIRAASAAEAKRLAQAQSSLPNGDMKVKAEP |
Length | 181 |
Position | Middle |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.369 |
Instability index | 32.95 |
Isoelectric point | 5.37 |
Molecular weight | 19707.15 |
Publications | PubMed=24919147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00345 No repeats found |
MoRF Sequence | Start | Stop |
1) DSFREIRAASAAEAKRLAQAQ 2) MKVKAE | 147 175 | 167 180 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab