<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00341
Description |
Uncharacterized protein |
Sequence | MLSFGGGVARIGSSVLMCKRASERRIMNRGGGAGAGLGSGSGPTAAAAAAAAQKQKTLLQRVENDIGNIVDNFSHLVNVARVNDPPVRNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIVEFNQQAEKSDRTLSRIVEEAAASLKELESHYYSSLQRTTHPTES |
Length | 182 |
Position | Head |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.285 |
Instability index | 38.82 |
Isoelectric point | 8.85 |
Molecular weight | 19591.92 |
Publications | PubMed=24919147
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00341
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.29| 13| 14| 127| 139| 1
---------------------------------------------------------------------------
127- 139 (22.17/18.10) ASLNDHVEQRIVE
144- 156 (21.12/16.94) AEKSDRTLSRIVE
---------------------------------------------------------------------------
|