<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00339
Description |
Uncharacterized protein |
Sequence | MNRGGGAGAGLGSGSGPTAAAAAAAAQKQKTLLQRVENDIGNIVDNFSHLVNVARVNDPPVRNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIVEFNQQAEKSDRTLSRIVEEAAASLKELESHYYSSLQRTTHPTES |
Length | 156 |
Position | Head |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.381 |
Instability index | 33.81 |
Isoelectric point | 6.08 |
Molecular weight | 16827.62 |
Publications | PubMed=24919147
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00339
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.29| 13| 14| 101| 113| 1
---------------------------------------------------------------------------
101- 113 (22.17/14.72) ASLNDHVEQRIVE
118- 130 (21.12/13.77) AEKSDRTLSRIVE
---------------------------------------------------------------------------
|