Description | Uncharacterized protein |
Sequence | MNRGGGAGAGLGSGSGPTAAAAVAAAQKQKTLLQRVENDIGNIVDNFSHLVNVARVNDPPVRNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIVEFNQQAEKSDRTLSRIAEEAAASLKELESHYYSSLQRTTHPTES |
Length | 156 |
Position | Head |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.381 |
Instability index | 34.35 |
Isoelectric point | 6.08 |
Molecular weight | 16827.62 |
Publications | PubMed=24919147 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00338 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LESHY 2) SRIAEE | 139 126 | 143 131 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab