| Description | Uncharacterized protein |
| Sequence | MNRGGGAGAGLGSGSGPTAAAAVAAAQKQKTLLQRVENDIGNIVDNFSHLVNVARVNDPPVRNSQEAFMMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIVEFNQQAEKSDRTLSRIAEEAAASLKELESHYYSSLQRTTHPTES |
| Length | 156 |
| Position | Head |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.381 |
| Instability index | 34.35 |
| Isoelectric point | 6.08 |
| Molecular weight | 16827.62 |
| Publications | PubMed=24919147 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP00338 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LESHY 2) SRIAEE | 139 126 | 143 131 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab