<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00327
Description |
Uncharacterized protein |
Sequence | MMDRKVDRRFGSGPKELCGAVDLISRFRLQPYHEFFCKKPLPISVSDTNYLKSVVGDREIRKAERLNSDQLSLTPPHVKKGGSQIHAFDMKVLWEAFEIRQAPSLCLFPGVERANTAVAKYGHKGKRKHKSHKTKRKDNKRSKHHHHHDKKDGIKK |
Length | 156 |
Position | Head |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.963 |
Instability index | 37.12 |
Isoelectric point | 10.14 |
Molecular weight | 18031.67 |
Publications | PubMed=24919147
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP00327
No repeats found
No repeats found
|