<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00277
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQHQISHSPARLGLTSPTSSSSPSLSNPNPAKFAAAVAAAAHQQPHHHPNLPPASSSSAAAAAAAAAVPATSSTLLSLLPPLPRAQSLLLQMSALASKLFDVSPNRALWLSSFRGSLPSFLSAQSPPPPPAQSHGAALPEPPPSSTKEILALFTSLQTQLFKAVAELQEILDLQDARQKLTREIRSNDSALLSFANRLKDAEHVLDVLVDDYADYRRPKRSRSASAAAEDDGDDDLGGGSTTTVASRLNLSNIVSYAHRISYTTFAPPDFGAGQAPLRGALPPAPQDEQMRISQLYNVEDIQLPKSAVQDDHKESISMVEPANPDVPAIPGLPTNIIIPSGWKPGMPVELPTDLPVPPPGWKPGDPIALPPMDTLPVRRPEEPQLQPVGPPGLHKEPETIQVRHVDLELPDNFDDSSDYSSDDASSEDDE |
| Length | 431 |
| Position | Middle |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.380 |
| Instability index | 74.69 |
| Isoelectric point | 4.92 |
| Molecular weight | 45863.75 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:EnsemblPlants
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00277
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.42| 18| 20| 338| 357| 1
---------------------------------------------------------------------------
340- 357 (40.93/23.49) PSGWKPGMPVELP.TD.LPV
359- 378 (32.49/12.02) PPGWKPGDPIALPpMDtLPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.11| 14| 20| 29| 42| 2
---------------------------------------------------------------------------
29- 42 (25.61/14.96) PN..PAKFAAAVAAAA
50- 65 (20.50/10.36) PNlpPASSSSAAAAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.43| 11| 19| 113| 128| 3
---------------------------------------------------------------------------
113- 128 (16.17/12.32) SFRGSLPsflsaQSPP
134- 144 (21.26/ 6.61) SHGAALP.....EPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.78| 11| 19| 379| 389| 4
---------------------------------------------------------------------------
379- 389 (20.54/11.73) RRPEEPQLQPV
396- 406 (19.24/10.52) KEPETIQVRHV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.61| 19| 32| 169| 187| 6
---------------------------------------------------------------------------
169- 187 (31.16/22.04) QEILD.LQDARQKLTREIRS
203- 222 (29.46/20.45) EHVLDvLVDDYADYRRPKRS
---------------------------------------------------------------------------
|