<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00276

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMATPPLGAMQFDGNPMAAAAAAAPQPPATDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDFTCNNEQLRLRSIHPLDMPQLSKMTGIEYALSEVLEPNLFVIRKQKRDGPDKVTHMLTYYVLDGSVYQAPQLSSVFAARIGRALYYISKAFTTAASKLEKIGYVDGEDESSASDSKVPKETIDIKEVKRIDHILASLQRRLPPAPAPPPFPEGYAPSTTEAEKGAETQQAAESIPTIDPIIDQGPAKRTKF
Length254
PositionHead
OrganismEucalyptus grandis (Flooded gum)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
Aromaticity0.09
Grand average of hydropathy-0.327
Instability index57.62
Isoelectric point5.32
Molecular weight28058.64
Publications
PubMed=24919147

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coactivator activity	GO:0003713	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP00276
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.16|      17|      24|     122|     138|       1
---------------------------------------------------------------------------
  122-  138 (29.04/17.66)	YYVLDGSVYQAPQLSSV
  148-  164 (27.12/16.10)	YYISKAFTTAASKLEKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.41|      32|      44|     166|     197|       3
---------------------------------------------------------------------------
  166-  197 (50.68/32.48)	YVDGEDESSASDSKVPKETIDIKEVKRIDHIL
  213-  244 (52.74/34.06)	FPEGYAPSTTEAEKGAETQQAAESIPTIDPII
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP00276 with Med6 domain of Kingdom Viridiplantae

Unable to open file!