Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATPPLGAMQFDGNPMAAAAAAAPQPPATDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDFTCNNEQLRLRSIHPLDMPQLSKMTGIEYALSEVLEPNLFVIRKQKRDGPDKVTHMLTYYVLDGSVYQAPQLSSVFAARIGRALYYISKAFTTAASKLEKIGYVDGEDESSASDSKVPKETIDIKEVKRIDHILASLQRRLPPAPAPPPFPEGYAPSTTEAEKGAETQQAAESIPTIDPIIDQGPAKRTKF |
Length | 254 |
Position | Head |
Organism | Eucalyptus grandis (Flooded gum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.327 |
Instability index | 57.62 |
Isoelectric point | 5.32 |
Molecular weight | 28058.64 |
Publications | PubMed=24919147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP00276 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.16| 17| 24| 122| 138| 1 --------------------------------------------------------------------------- 122- 138 (29.04/17.66) YYVLDGSVYQAPQLSSV 148- 164 (27.12/16.10) YYISKAFTTAASKLEKI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 103.41| 32| 44| 166| 197| 3 --------------------------------------------------------------------------- 166- 197 (50.68/32.48) YVDGEDESSASDSKVPKETIDIKEVKRIDHIL 213- 244 (52.74/34.06) FPEGYAPSTTEAEKGAETQQAAESIPTIDPII --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FPEGYAPSTTEAEKGAETQQAAESIPTIDPIID 2) KEVKRIDHILASLQRRLP | 213 188 | 245 205 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab