<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00276
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATPPLGAMQFDGNPMAAAAAAAPQPPATDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDFTCNNEQLRLRSIHPLDMPQLSKMTGIEYALSEVLEPNLFVIRKQKRDGPDKVTHMLTYYVLDGSVYQAPQLSSVFAARIGRALYYISKAFTTAASKLEKIGYVDGEDESSASDSKVPKETIDIKEVKRIDHILASLQRRLPPAPAPPPFPEGYAPSTTEAEKGAETQQAAESIPTIDPIIDQGPAKRTKF |
| Length | 254 |
| Position | Head |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.327 |
| Instability index | 57.62 |
| Isoelectric point | 5.32 |
| Molecular weight | 28058.64 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00276
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.16| 17| 24| 122| 138| 1
---------------------------------------------------------------------------
122- 138 (29.04/17.66) YYVLDGSVYQAPQLSSV
148- 164 (27.12/16.10) YYISKAFTTAASKLEKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.41| 32| 44| 166| 197| 3
---------------------------------------------------------------------------
166- 197 (50.68/32.48) YVDGEDESSASDSKVPKETIDIKEVKRIDHIL
213- 244 (52.74/34.06) FPEGYAPSTTEAEKGAETQQAAESIPTIDPII
---------------------------------------------------------------------------
|