<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00268
| Description |
Uncharacterized protein |
| Sequence | MGVCKRPTARYGRSNLRCFRKRYVGDQVLMAYGDWREEAYQKLKSMRESYMPELNEMYEKISRKLQQHKSLPQQPKPELLEKLKAFRTMLERVIAILQFNRADIVPLVPSFKEKLVHYEKQIINFINTSRSRKVAMQQGQPPPPHMHSS |
| Length | 149 |
| Position | Tail |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.764 |
| Instability index | 59.98 |
| Isoelectric point | 10.04 |
| Molecular weight | 17694.53 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00268
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.22| 22| 24| 32| 54| 1
---------------------------------------------------------------------------
32- 54 (35.71/26.29) YgDWREEAYQKLKSMRESYMPEL
58- 79 (36.51/21.76) Y.EKISRKLQQHKSLPQQPKPEL
---------------------------------------------------------------------------
|