<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00263
| Description |
Uncharacterized protein |
| Sequence | MDPESKNFGKGSRELTGSVDLINHFKLSPHHDFFCKKSLPLSLSDTHYLHNLVGDTEIRKGEGMQLDQLIQSTSNGRDSHFRIQPFDLDSLRDAFHLRETTRVDLPATEKGIPTISGKSRSESKDKEKKHKKHKDRDKEKDREHKKHKHRHKDRSKDKDKERKKDKVGQHDSGVDNSKKHHEKKRKHDGDEDLNEHKHKKSKHKSAKLDEVGVIRVAG |
| Length | 218 |
| Position | Head |
| Organism | Eucalyptus grandis (Flooded gum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Myrtaceae> Myrtoideae> Eucalypteae> Eucalyptus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.547 |
| Instability index | 33.96 |
| Isoelectric point | 9.60 |
| Molecular weight | 25283.99 |
| Publications | PubMed=24919147
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00263
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.77| 15| 15| 139| 153| 2
---------------------------------------------------------------------------
139- 153 (28.25/10.81) EKDREHKKHKHRHKD
157- 171 (24.03/ 8.07) DKDKERKKDKVGQHD
173- 187 (23.50/ 7.73) GVDNSKKHHEKKRKH
---------------------------------------------------------------------------
|