<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00253

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMGDDDWPSQRFRDHVINRLEPELARNRQNAPNLPVPGDARQVEEYVFNKCVSKDEYMRTIAKVINAINCNSKSTTVPALLQPSRIQSASQNYRAAGLGVPPDPQPTQQQQQQQKVMDRYHTPLLGQPPPIIQSQQSSSGALSRTSMQPSQSNIQQHSPVTHPVVPQQTPYNMLSPIPSVPGSHSTSPNHQMYSLVKTEPKSGGSDGTNAAEVPISDSVSARVWKREDPSSGGYYPAGTYGATDSDQYVERGHSTASFMSRGTSIPSSQQQSISRHHQQLHQPSVLENLINSPHYGSPTPSSRHLNGSGNQNVADLPFGTTLQQSEERIYAEKLRSLRPYVESLRSRAQQCRLEGNEIAASKFDTMCNVLDGKSRVSFEYLLQIEAWIYKKQQFLQASLNAGTLQPQPLVDAVNAVLLNSETQVGYGDRVQANAGVPSAGQWPMSSGRSQQQQQQTSSQVLASMAPSSVPVAVCLARSTLMQSPMPLQTTSGQQVARHSVEHTYQRHSPYPNPNAGLRPGTQAQSMVLHHGSSRVQQAGAVATALPLFSESNRVPTADCSGVEDLYIMDDFLPTPIEAIPNSTSSQIEGQLPEAARQELLTFGDRFLADSNIEQISDSHSVVVKFSLTSHNVPPLQLIIPKTYPNGEVLVGRAALDLDSFFFDDLQNVIYERLARPGLRTVADFLETWESTVRGYYLGQQQQSLLPSSFDDILQNTNFGDFLS
Length722
PositionTail
OrganismOnchocerca volvulus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
Aromaticity0.07
Grand average of hydropathy-0.556
Instability index66.30
Isoelectric point6.03
Molecular weight79309.26
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
nuclear hormone receptor binding	GO:0035257	IEA:EnsemblMetazoa
transcription coactivator activity	GO:0003713	IEA:EnsemblMetazoa
GO - Biological Process
determination of adult lifespan	GO:0008340	IEA:EnsemblMetazoa
embryo development ending in birth or egg hatching	GO:0009792	IEA:EnsemblMetazoa
locomotion	GO:0040011	IEA:EnsemblMetazoa
nematode larval development	GO:0002119	IEA:EnsemblMetazoa
regulation of fatty acid metabolic process	GO:0019217	IEA:EnsemblMetazoa
regulation of multicellular organism growth	GO:0040014	IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
sequestering of triglyceride	GO:0030730	IEA:EnsemblMetazoa

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP00253
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     200.08|      37|      44|      77|     113|       1
---------------------------------------------------------------------------
   77-  109 (51.34/24.65)	............P......AL..LQPSRIQSASQNYRAAGLGVPPDPQ.PT...QQQ
  110-  152 (49.68/23.60)	QQQQkvmdryhtP......LL..GQPPPIIQ.SQQSSSGALS.RTSMQ.PS...QSN
  380-  405 (26.07/ 8.56)	....................L..LQIEAWIYKKQQFLQASLNAGT.LQ.P.......
  406-  449 (28.68/10.22)	...Q........PlvdavnAV..LLNSETQVGYGDRVQANAGVPSAGQwPMssgRSQ
  450-  492 (44.31/20.17)	QQQQ....qtssQ......VLasMAPSSVPVAVCLARSTLMQSPMPLQ.TT...SGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     327.96|     126|     341|     153|     363|       2
---------------------------------------------------------------------------
  153-  188 ( 4.78/24.36)	........................................................................................................................IQQHSPvTHPVVPQ..QTPYNmLSPIP.SVPgshSTSPN
  217-  318 (138.07/113.45)	SVsARVWKREDPssggyYP...AGTYGATDSDQYVERgHSTASFMSRG...TSIP..SSQQQSISRHHQQLHQPSVLENLINSPHYGSPTPSSRHLNGSGNQNVAD..LPFG...............................................
  498-  644 (185.12/81.81)	SV.EHTYQRHSP.....YPnpnAGLRPGTQAQSMVLH.HGSSRVQQAGavaTALPlfSESNRVPTADCSGVEDLYIMDDFLPTPIEAIPNSTSSQIEGQLPEAARQelLTFGdrfladsnIEQISD.SHSVVVKfsLTSHN.VPPLQlIIP...KTYPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     123.91|      38|     331|     326|     363|       3
---------------------------------------------------------------------------
  326-  363 (63.24/41.66)	ERIYAEKLRSLRPYVESLRSRAQQCRL..EGNEIAASKFD
  670-  709 (60.67/39.67)	ERLARPGLRTVADFLETWESTVRGYYLgqQQQSLLPSSFD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP00253 with Med15 domain of Kingdom Metazoa

Unable to open file!