<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00251
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MMQASGPGRTVMIGQSQGTYMGIPNVASQPGSAYQQTVSMLHQSFKNPNWPPNFITPDNVLDYFCDPGNVFYDVSSCNQHIRMQNLNRPLHECLQSMQGIQYTVVGTFPPLYVIMKQRRNSPTNVTPLAYYYIVNGTVYQCPDIYTYIQSKLISIVDPLRQALEQARNFNRFNIAKGYYWEFKDSDGETVKKAIEEEEKPQLVRSTFYQRTRTDQILRELFAKFPLPDDVQFNFGGNEISGENEAIPTGDIGEKSVQNSTINNQDLTVTEDPATGINRHPAFTSPSSVPVIPANRSTGESSSGPLSFPGTAPVLGTACTDSQHEIDAKRFKGS |
| Length | 333 |
| Position | Head |
| Organism | Onchocerca volvulus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.511 |
| Instability index | 52.39 |
| Isoelectric point | 5.60 |
| Molecular weight | 37162.19 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00251
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.57| 20| 20| 272| 291| 1
---------------------------------------------------------------------------
272- 291 (35.89/19.36) PATGINRHPAFTSPSSVPVI
295- 314 (34.68/18.48) RSTGESSSGPLSFPGTAPVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.82| 22| 25| 4| 25| 3
---------------------------------------------------------------------------
4- 25 (43.55/27.61) ASGPG....RTV.MIGQSQGTYMGIPN
27- 53 (36.26/21.81) ASQPGsayqQTVsMLHQSFKNPNWPPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.12| 22| 47| 110| 132| 4
---------------------------------------------------------------------------
110- 132 (37.77/30.13) PLYVIMKQRRN.SPTNVTPlAYYY
158- 180 (37.35/24.79) PLRQALEQARNfNRFNIAK.GYYW
---------------------------------------------------------------------------
|