Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDPSLMGSMSNAPVLQETATDTRYNQLEQTLENFQENARQMGVIASDFTTRSQEPLNQKIHTLISGLHELDHLKNQFMDVKIPLELLEYLDQGKNPQLYTKECLERTLNKNKEMNGKIEMYKKFRAMLLKELGEEMPNDMVLYRNLRDRKDTSPQHENYEDTSD |
Length | 164 |
Position | Middle |
Organism | Onchocerca volvulus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.929 |
Instability index | 38.56 |
Isoelectric point | 5.07 |
Molecular weight | 19215.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00235 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.65| 13| 19| 81| 99| 1 --------------------------------------------------------------------------- 67- 79 (23.36/ 6.17) LHELDHLKNQFMD 87- 99 (23.29/17.41) LEYLDQGKNPQLY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.53| 14| 19| 112| 125| 2 --------------------------------------------------------------------------- 112- 125 (24.26/15.81) KEMNGKIEMYKKFR 134- 147 (23.27/14.89) EEMPNDMVLYRNLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKFRAMLLKEL 2) MVLYRNLRDRK | 122 140 | 132 150 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab