<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00216

Description Mediator of RNA polymerase II transcription subunit
SequenceMECLLVHTIYIRTRNRLSELKQELQTMLKDVECTLAGSPAILSVPILQPCLRAELLLVTVDTHTGMLQCHVPQYDAPLVPELTVALNGDHSRLSTLISELRFWITQRRCEKTLQHLPATAHERLPVLHHPDHPMSKISRHRIFVQLHRHPTVILIVAFKEKESSPCEIECSFYLAVVKHSSIEDDPHDDSIETEIPKMYLKVQSLIEFDTFVITHGPFTSVDSEVVETANNKRKSTGIGGRTDATGTSQNRRPKHPAYFIPELAHVVALCDERIPFVTLAQELTRREIAHQGLQVEANATALVLKLVQLPAPIPSIATSSAWHALLKRLLSVSIRVQGKGMAKTWTVEFVFYGSPLSSSHPKEQGLRRPVYFQYEMGTSDTVSRTVDALLNDWAQIVHLYMIVHDLAEYLKMEKYNLRNMVSIKSYSYSKLVLAYGENQVATVTVQWSTNDKAFRLLFGRSPANIVTNPHSIMKEQLEAHLNRHTNLAQIIHILNETLPPLMSISKLPIIPQLCVHARPRVPVQTFTIMPQCVTLVRIAYQGMYCLELRLRGGGLVSLRDGAYSRFDRSNVVDEFTPTQGLKGFLSKYVDENAVCRRRSQSEDDNPPSPVTMDSDGSSGNVGFLSHHRSGPQSPAQQREGLRFHPPLTPPSGSNPHTPASPHTANISQASQHQSFGSSPATSFNLASPPSLPPNTPNMLPHPSPGSGLVANSPLNPMHVPSPAGLMPTSSPGPCSNVQVGHSPAGSFMQTGHIDGSPFPSSQSMASPAASNWPGSPSVPRPSPARPGQNPSHAALHSPQASDHKTVTHISRVLPPRSWAGAVPTLLTNEALDLLCSPSAHPSLSNLAGLNLPGMSPLERFLGCVYMRRQLQRFIQTDDCLTSINSTEPGVVHFKVESLQCRVGLNQQHMQSLHIKVQPVPEYKDQWTIEELQIIEKFFDTRVAAPPYKHNTLSGFGRMLNVRFKVLKDFVQIMKLELVPGFVQQLQLKWSVQLCLRIPPSAGPIVPPGTEGVHVCRSKILFFLQITRAALQFQGEMPSLVLPFVYDVTTNLTQLAERRDLSPPPPAITAASMQLKRFAEYGANQSECSLFPAVRDLLANFTLPSEPPVISQVVASPAGGQVTPTQQQIQNTAMQMHSPMAGGQGPPQGPYGMQGMPPMGMMGGPPQ
Length1166
PositionTail
OrganismOoceraea biroi (Clonal raider ant) (Cerapachys biroi)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Dorylinae> Ooceraea.
Aromaticity0.06
Grand average of hydropathy-0.214
Instability index64.33
Isoelectric point8.60
Molecular weight128506.16
Publications
PubMed=24508170

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00216
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.57|      15|      17|    1133|    1147|       1
---------------------------------------------------------------------------
 1133- 1147 (30.17/10.13)	MQMHSPMAGGQGPPQ
 1152- 1166 (30.39/10.26)	MQGMPPMGMMGGPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     293.36|      39|      68|     692|     730|       2
---------------------------------------------------------------------------
  606-  648 (45.15/20.36)	P.PSPVTM.DSDGSS.GN...vG....FLSHHRSGPQ......SP.......AqqreGLrfH....PPLT
  649-  691 (50.56/23.89)	P.PSGSN...PH.TP.AS....P....HTANISQASQHqsfGSSP.......A....TS..FnlasPPSL
  692-  730 (78.41/42.09)	P.PNTPNM.LPHPSP.GS....G....LVANSPLNPMH...VPSP.......A....GL..M....PTSS
  731-  770 (37.76/15.52)	P.GPCSNVqVGH.SPaGSfmqtG....HIDGSPF........PSS.......Q....SM..A...sPAAS
  771-  801 (42.18/18.42)	NwPGSPS..VPRPSP..............ARPGQNPSH..............A....AL..H...sPQAS
  806-  855 (39.30/16.54)	V.THISRV.LP.PRS.WA....GavptLLTNEALDLLC...SPSAhpslsnlA....GL.nL....PGMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.19|      15|      18|     500|     515|       3
---------------------------------------------------------------------------
  500-  515 (24.20/17.93)	PLMSISKLPIIPQlCV
  519-  533 (29.99/17.83)	PRVPVQTFTIMPQ.CV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.92|      19|      20|     878|     896|       4
---------------------------------------------------------------------------
  878-  896 (32.83/20.67)	DCLTSINSTEPGVVHFKVE
  899-  917 (34.09/21.75)	QCRVGLNQQHMQSLHIKVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.89|      28|      52|    1023|    1074|       5
---------------------------------------------------------------------------
 1033- 1067 (44.23/53.50)	QGEMPSLVLPFVYDVTTNLTqlaerrdLSPPPPAI
 1082- 1109 (49.66/15.51)	ANQSECSLFPAVRDLLANFT.......LPSEPPVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.25|      16|      20|     433|     452|      10
---------------------------------------------------------------------------
  433-  448 (27.87/23.15)	LAYGENQVATVTVQWS
  456-  471 (28.38/12.42)	LLFGRSPANIVTNPHS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00216 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) CRRRSQSEDDNPPSPVTMDSDGSSGNVGFLSHHRSGPQSPAQQREGLRFHPPLTPPSGSNPHTPASPHTANISQASQHQSFGSSPATSFNLASPPSLPPNTPNMLPHPSPGSGLVANSPLNPMHVPSPAGLMPTSSPGPCSNVQVGHSPAGSFMQTGHIDGSPFPSSQSMASPAASNWPGSPSVPRPSPARPGQNPSHAALHSPQASDHKTVTHISRVL
2) QVVASPAGGQVTPTQQQIQNTAMQMHSPMAGGQGPPQGPYGMQGMPPMGMMGGPPQ
595
1111
813
1166










Molecular Recognition Features






MoRF SequenceStartStop




NANANA