<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00190
| Description |
Putative mediator of rna polymerase ii transcription subunit 27 |
| Sequence | MNQEPVNTALSQLRMLRSSVGQVFEILGNGVRAEHGEEGREQKFIQELQELLAVVNGNLREFETGISDLTPPQAPFNLANTAYLSLETNLERQALYPHLVQSYKWHDKLHEYSTFASVLLQQNSLKRSYYTNTKRRRSLPSSHLATPQTVDNLIGSIHFPNMNLKIVRPFMTNAILHITIARVLRAAVILKGLLIEWVTVKGYDESLLDGVDEHWTVSRHQVFRKVQDHAHSAMLHFFSPTLPDLAIRSFITWFRSYLTLFADPCKKCGKHLHNTLPPTWRDLRTLEPYHEECKQ |
| Length | 295 |
| Position | Tail |
| Organism | Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.337 |
| Instability index | 49.01 |
| Isoelectric point | 8.70 |
| Molecular weight | 34006.51 |
| Publications | PubMed=24945155
PubMed=26483478
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.22| 15| 26| 252| 267| 1
---------------------------------------------------------------------------
252- 267 (25.36/22.38) TW..FRSyLTLFADPCKK
279- 295 (25.86/16.55) TWrdLRT.LEPYHEECKQ
---------------------------------------------------------------------------
|