Description | Uncharacterized protein (Fragment) |
Sequence | MEVATHMKCSNIWESIIGQTKVAQSKGSDPMTWSIEISSELRSLGISLPCVELGKHLVSHICWQNNVPIAW |
Length | 71 |
Position | Tail |
Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Phrymaceae> Erythranthe. |
Aromaticity | 0.06 |
Grand average of hydropathy | 0.039 |
Instability index | 52.64 |
Isoelectric point | 6.24 |
Molecular weight | 7907.09 |
Publications | PubMed=24225854 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00182 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IWESIIGQTKV 2) KGSDPMTWSIEI 3) MEVATH | 12 26 1 | 22 37 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab