| Description | Uncharacterized protein (Fragment) |
| Sequence | MEVATHMKCSNIWESIIGQTKVAQSKGSDPMTWSIEISSELRSLGISLPCVELGKHLVSHICWQNNVPIAW |
| Length | 71 |
| Position | Tail |
| Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Phrymaceae> Erythranthe. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.039 |
| Instability index | 52.64 |
| Isoelectric point | 6.24 |
| Molecular weight | 7907.09 |
| Publications | PubMed=24225854 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP00182 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IWESIIGQTKV 2) KGSDPMTWSIEI 3) MEVATH | 12 26 1 | 22 37 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab